General Information

  • ID:  hor005320
  • Uniprot ID:  P0CJ23
  • Protein name:  Neuropeptide Y2-like conopeptide
  • Gene name:  NA
  • Organism:  Conus betulinus (Beech cone)
  • Family:  NPY family
  • Source:  animal
  • Expression:  Expressed by the venom duct.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Dendroconus (subgenus), Conus (genus), Conidae (family), Conoidea (superfamily), Neogastropoda (order), Caenogastropoda (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TVSDPPARPAVFHSREELMNYVRELNLYFAIVGRPRY
  • Length:  37
  • Propeptide:  TVSDPPARPAVFHSREELMNYVRELNLYFAIVGRPRY
  • Signal peptide:  NA
  • Modification:  T37 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes hyperactivity such as jumping, rapid circling and tail flicking, after intraventicular injection into mouse brain
  • Mechanism:  The mature peptide does not contain cysteine residue.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0CJ23-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P0CJ23-F1.pdbhor005320_AF2.pdbhor005320_ESM.pdb

Physical Information

Mass: 500727 Formula: C198H304N56O54S
Absent amino acids: CKQW Common amino acids: R
pI: 9.07 Basic residues: 6
Polar residues: 9 Hydrophobic residues: 13
Hydrophobicity: -38.11 Boman Index: -8096
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 81.62
Instability Index: 4110.81 Extinction Coefficient cystines: 4470
Absorbance 280nm: 124.17

Literature

  • PubMed ID:  20705590
  • Title:  Identification of neuropeptide Y-like conopeptides from the venom of Conus betulinus.